P Glycoprotein/ABCB1 Antibody orb421108 from Biorbyt

Product Specs
ItemP Glycoprotein/ABCB1 Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb421108
ApplicationsFC, ICC, IF, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetP Glycoprotein/ABCB1
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY)
NCBI Full Gene NameATP binding cassette subfamily B member 1
NCBI Gene AliasesABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1, p-170
ClonalityPolyclonal
Quantity10 µg, 100 µg
IsotypeRabbit IgG
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles